Anti-SMAD7
Catalog Number:
ATA-HPA028897
- Images (9)
| Article Name: | Anti-SMAD7 |
| Biozol Catalog Number: | ATA-HPA028897 |
| Supplier Catalog Number: | HPA028897 |
| Alternative Catalog Number: | ATA-HPA028897-100,ATA-HPA028897-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MADH7, MADH8 |
| SMAD family member 7 |
| Anti-SMAD7 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 4092 |
| UniProt: | O15105 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SMAD7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center, cytosol & centrosome. |
|
|
Immunohistochemical staining of human lung shows nuclear positivity in pneumnocytes and macropages. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows nuclear positivity in Kupffer cells. |
|
|
HPA028897-100ul |
|
|
|
|
|
HPA028897-100ul |
|
|
HPA028897-100ul |
Product Guarantee and Expert Support
