Anti-PSMB11
Artikelnummer:
ATA-HPA028967
- Bilder (8)
| Artikelname: | Anti-PSMB11 |
| Artikelnummer: | ATA-HPA028967 |
| Hersteller Artikelnummer: | HPA028967 |
| Alternativnummer: | ATA-HPA028967-100,ATA-HPA028967-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | beta5t |
| proteasome subunit beta 11 |
| Anti-PSMB11 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 122706 |
| UniProt: | A5LHX3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALAR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PSMB11 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human colon, kidney, lymph node and thymus using Anti-PSMB11 antibody HPA028967 (A) shows similar protein distribution across tissues to independent antibody HPA056970 (B). |
|
|
Immunohistochemical staining of human colon using Anti-PSMB11 antibody HPA028967. |
|
|
Immunohistochemical staining of human thymus using Anti-PSMB11 antibody HPA028967. |
|
|
Immunohistochemical staining of human lymph node using Anti-PSMB11 antibody HPA028967. |
|
|
Immunohistochemical staining of human kidney using Anti-PSMB11 antibody HPA028967. |
|
|
HPA028967-100ul |
|
|
HPA028967-100ul |
|
|
HPA028967-100ul |
Produktgarantie und fachkundiger Support
