Anti-PSMB11
Catalog Number:
ATA-HPA028967
- Images (8)
| Article Name: | Anti-PSMB11 |
| Biozol Catalog Number: | ATA-HPA028967 |
| Supplier Catalog Number: | HPA028967 |
| Alternative Catalog Number: | ATA-HPA028967-100,ATA-HPA028967-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | beta5t |
| proteasome subunit beta 11 |
| Anti-PSMB11 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 122706 |
| UniProt: | A5LHX3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALAR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PSMB11 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human colon, kidney, lymph node and thymus using Anti-PSMB11 antibody HPA028967 (A) shows similar protein distribution across tissues to independent antibody HPA056970 (B). |
|
|
Immunohistochemical staining of human colon using Anti-PSMB11 antibody HPA028967. |
|
|
Immunohistochemical staining of human thymus using Anti-PSMB11 antibody HPA028967. |
|
|
Immunohistochemical staining of human lymph node using Anti-PSMB11 antibody HPA028967. |
|
|
Immunohistochemical staining of human kidney using Anti-PSMB11 antibody HPA028967. |
|
|
HPA028967-100ul |
|
|
HPA028967-100ul |
|
|
HPA028967-100ul |
Product Guarantee and Expert Support
