Anti-KCNJ2
Artikelnummer:
ATA-HPA029109
- Bilder (7)
| Artikelname: | Anti-KCNJ2 |
| Artikelnummer: | ATA-HPA029109 |
| Hersteller Artikelnummer: | HPA029109 |
| Alternativnummer: | ATA-HPA029109-100,ATA-HPA029109-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IRK1, Kir2.1, LQT7 |
| potassium inwardly-rectifying channel, subfamily J, member 2 |
| Anti-KCNJ2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3759 |
| UniProt: | P63252 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KCNJ2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
HPA029109-100ul |
|
|
HPA029109-100ul |
|
|
HPA029109-100ul |
Produktgarantie und fachkundiger Support
