Anti-KCNJ2
Catalog Number:
ATA-HPA029109
- Images (7)
| Article Name: | Anti-KCNJ2 |
| Biozol Catalog Number: | ATA-HPA029109 |
| Supplier Catalog Number: | HPA029109 |
| Alternative Catalog Number: | ATA-HPA029109-100,ATA-HPA029109-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IRK1, Kir2.1, LQT7 |
| potassium inwardly-rectifying channel, subfamily J, member 2 |
| Anti-KCNJ2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 3759 |
| UniProt: | P63252 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KCNJ2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
HPA029109-100ul |
|
|
HPA029109-100ul |
|
|
HPA029109-100ul |
Product Guarantee and Expert Support
