Anti-FPR2
Artikelnummer:
ATA-HPA029154
- Bilder (7)
| Artikelname: | Anti-FPR2 |
| Artikelnummer: | ATA-HPA029154 |
| Hersteller Artikelnummer: | HPA029154 |
| Alternativnummer: | ATA-HPA029154-100,ATA-HPA029154-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH2, FPRL1, HM63, LXA4R |
| formyl peptide receptor 2 |
| Anti-FPR2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2358 |
| UniProt: | P25090 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DTYCTFNFASWGGTPEERLKVAITMLTARG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FPR2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in granulocytes. |
|
|
Immunohistochemical staining of human colon shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human prostate shows no cytoplasmic positivity in glandular cells as expected. |
|
|
HPA029154-100ul |
|
|
HPA029154-100ul |
|
|
HPA029154-100ul |
Produktgarantie und fachkundiger Support
