Anti-FPR2
Catalog Number:
ATA-HPA029154
- Images (7)
| Article Name: | Anti-FPR2 |
| Biozol Catalog Number: | ATA-HPA029154 |
| Supplier Catalog Number: | HPA029154 |
| Alternative Catalog Number: | ATA-HPA029154-100,ATA-HPA029154-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH2, FPRL1, HM63, LXA4R |
| formyl peptide receptor 2 |
| Anti-FPR2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 2358 |
| UniProt: | P25090 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DTYCTFNFASWGGTPEERLKVAITMLTARG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FPR2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in granulocytes. |
|
|
Immunohistochemical staining of human colon shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human prostate shows no cytoplasmic positivity in glandular cells as expected. |
|
|
HPA029154-100ul |
|
|
HPA029154-100ul |
|
|
HPA029154-100ul |
Product Guarantee and Expert Support
