Anti-ITM2B

Artikelnummer: ATA-HPA029292
Artikelname: Anti-ITM2B
Artikelnummer: ATA-HPA029292
Hersteller Artikelnummer: HPA029292
Alternativnummer: ATA-HPA029292-100,ATA-HPA029292-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BRI, BRICD2B, E25B, E3-16
integral membrane protein 2B
Anti-ITM2B
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9445
UniProt: Q9Y287
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ITM2B
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.
HPA029292-100ul
HPA029292-100ul
HPA029292-100ul