Anti-ITM2B
Catalog Number:
ATA-HPA029292
- Images (9)
| Article Name: | Anti-ITM2B |
| Biozol Catalog Number: | ATA-HPA029292 |
| Supplier Catalog Number: | HPA029292 |
| Alternative Catalog Number: | ATA-HPA029292-100,ATA-HPA029292-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BRI, BRICD2B, E25B, E3-16 |
| integral membrane protein 2B |
| Anti-ITM2B |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9445 |
| UniProt: | Q9Y287 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ITM2B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells. |
|
|
HPA029292-100ul |
|
|
|
|
|
HPA029292-100ul |
|
|
HPA029292-100ul |
Product Guarantee and Expert Support
