Anti-ASNS
Artikelnummer:
ATA-HPA029318
- Bilder (9)
| Artikelname: | Anti-ASNS |
| Artikelnummer: | ATA-HPA029318 |
| Hersteller Artikelnummer: | HPA029318 |
| Alternativnummer: | ATA-HPA029318-100,ATA-HPA029318-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ASNS |
| asparagine synthetase (glutamine-hydrolyzing) |
| Anti-ASNS |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 440 |
| UniProt: | P08243 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ASNS |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Western blot analysis using Anti-ASNS antibody HPA029318 (A) shows similar pattern to independent antibody HPA064737 (B). |
|
|
HPA029318-100ul |
|
|
|
|
|
HPA029318-100ul |
|
|
HPA029318-100ul |
Produktgarantie und fachkundiger Support
