Anti-ASNS
Catalog Number:
ATA-HPA029318
- Images (9)
| Article Name: | Anti-ASNS |
| Biozol Catalog Number: | ATA-HPA029318 |
| Supplier Catalog Number: | HPA029318 |
| Alternative Catalog Number: | ATA-HPA029318-100,ATA-HPA029318-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ASNS |
| asparagine synthetase (glutamine-hydrolyzing) |
| Anti-ASNS |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 440 |
| UniProt: | P08243 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ASNS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Western blot analysis using Anti-ASNS antibody HPA029318 (A) shows similar pattern to independent antibody HPA064737 (B). |
|
|
HPA029318-100ul |
|
|
|
|
|
HPA029318-100ul |
|
|
HPA029318-100ul |
Product Guarantee and Expert Support
