Anti-MS4A4A
Artikelnummer:
ATA-HPA029323
- Bilder (7)
| Artikelname: | Anti-MS4A4A |
| Artikelnummer: | ATA-HPA029323 |
| Hersteller Artikelnummer: | HPA029323 |
| Alternativnummer: | ATA-HPA029323-100,ATA-HPA029323-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD20L1, MS4A4, MS4A7 |
| membrane-spanning 4-domains, subfamily A, member 4A |
| Anti-MS4A4A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51338 |
| UniProt: | Q96JQ5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLNEV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MS4A4A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human placenta shows membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lymph node shows membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no membranous positivity in myocytes as expected. |
|
|
HPA029323-100ul |
|
|
HPA029323-100ul |
|
|
HPA029323-100ul |
Produktgarantie und fachkundiger Support
