Anti-MS4A4A
Catalog Number:
ATA-HPA029323
- Images (7)
| Article Name: | Anti-MS4A4A |
| Biozol Catalog Number: | ATA-HPA029323 |
| Supplier Catalog Number: | HPA029323 |
| Alternative Catalog Number: | ATA-HPA029323-100,ATA-HPA029323-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD20L1, MS4A4, MS4A7 |
| membrane-spanning 4-domains, subfamily A, member 4A |
| Anti-MS4A4A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 51338 |
| UniProt: | Q96JQ5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLNEV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MS4A4A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human placenta shows membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lymph node shows membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no membranous positivity in myocytes as expected. |
|
|
HPA029323-100ul |
|
|
HPA029323-100ul |
|
|
HPA029323-100ul |
Product Guarantee and Expert Support
