Anti-C5
Artikelnummer:
ATA-HPA029339
- Bilder (7)
| Artikelname: | Anti-C5 |
| Artikelnummer: | ATA-HPA029339 |
| Hersteller Artikelnummer: | HPA029339 |
| Alternativnummer: | ATA-HPA029339-100,ATA-HPA029339-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C5a, C5b, CPAMD4 |
| complement component 5 |
| Anti-C5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 727 |
| UniProt: | P01031 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human placenta shows moderate positivity in plasma. |
|
|
HPA029339-100ul |
|
|
HPA029339-100ul |
|
|
HPA029339-100ul |
Produktgarantie und fachkundiger Support
