Anti-C5
Catalog Number:
ATA-HPA029339
- Images (7)
| Article Name: | Anti-C5 |
| Biozol Catalog Number: | ATA-HPA029339 |
| Supplier Catalog Number: | HPA029339 |
| Alternative Catalog Number: | ATA-HPA029339-100,ATA-HPA029339-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C5a, C5b, CPAMD4 |
| complement component 5 |
| Anti-C5 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 727 |
| UniProt: | P01031 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | C5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human placenta shows moderate positivity in plasma. |
|
|
HPA029339-100ul |
|
|
HPA029339-100ul |
|
|
HPA029339-100ul |
Product Guarantee and Expert Support
