Anti-LANCL2

Artikelnummer: ATA-HPA029535
Artikelname: Anti-LANCL2
Artikelnummer: ATA-HPA029535
Hersteller Artikelnummer: HPA029535
Alternativnummer: ATA-HPA029535-100,ATA-HPA029535-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GPR69B, TASP
LanC lantibiotic synthetase component C-like 2 (bacterial)
Anti-LANCL2
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 55915
UniProt: Q9NS86
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LANCL2
Antibody Type: Monoclonal Antibody
Application Verdünnung: WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and LANCL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412892).
HPA029535-100ul
HPA029535-100ul