Anti-LANCL2
Catalog Number:
ATA-HPA029535
- Images (8)
| Article Name: | Anti-LANCL2 |
| Biozol Catalog Number: | ATA-HPA029535 |
| Supplier Catalog Number: | HPA029535 |
| Alternative Catalog Number: | ATA-HPA029535-100,ATA-HPA029535-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GPR69B, TASP |
| LanC lantibiotic synthetase component C-like 2 (bacterial) |
| Anti-LANCL2 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 55915 |
| UniProt: | Q9NS86 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LANCL2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and LANCL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412892). |
|
|
HPA029535-100ul |
|
|
HPA029535-100ul |
Product Guarantee and Expert Support
