Anti-IMPA2

Artikelnummer: ATA-HPA029561
Artikelname: Anti-IMPA2
Artikelnummer: ATA-HPA029561
Hersteller Artikelnummer: HPA029561
Alternativnummer: ATA-HPA029561-100,ATA-HPA029561-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IMPA2
inositol(myo)-1(or 4)-monophosphatase 2
Anti-IMPA2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 3613
UniProt: O14732
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IMPA2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & mitochondria.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in renal tubules.
Western blot analysis in control (vector only transfected HEK293T lysate) and IMPA2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415429).
HPA029561-100ul
HPA029561-100ul
HPA029561-100ul