Anti-IMPA2

Catalog Number: ATA-HPA029561
Article Name: Anti-IMPA2
Biozol Catalog Number: ATA-HPA029561
Supplier Catalog Number: HPA029561
Alternative Catalog Number: ATA-HPA029561-100,ATA-HPA029561-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IMPA2
inositol(myo)-1(or 4)-monophosphatase 2
Anti-IMPA2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 3613
UniProt: O14732
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IMPA2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & mitochondria.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in renal tubules.
Western blot analysis in control (vector only transfected HEK293T lysate) and IMPA2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415429).
HPA029561-100ul
HPA029561-100ul
HPA029561-100ul