Anti-CHML

Artikelnummer: ATA-HPA029628
Artikelname: Anti-CHML
Artikelnummer: ATA-HPA029628
Hersteller Artikelnummer: HPA029628
Alternativnummer: ATA-HPA029628-100,ATA-HPA029628-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: REP-2
choroideremia-like (Rab escort protein 2)
Anti-CHML
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1122
UniProt: P26374
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CHML
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in purkinje cells.
Western blot analysis using Anti-CHML antibody HPA029628 (A) shows similar pattern to independent antibody HPA029627 (B).
HPA029628-100ul
HPA029628-100ul
HPA029628-100ul