Anti-CHML
Catalog Number:
ATA-HPA029628
- Images (7)
| Article Name: | Anti-CHML |
| Biozol Catalog Number: | ATA-HPA029628 |
| Supplier Catalog Number: | HPA029628 |
| Alternative Catalog Number: | ATA-HPA029628-100,ATA-HPA029628-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | REP-2 |
| choroideremia-like (Rab escort protein 2) |
| Anti-CHML |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1122 |
| UniProt: | P26374 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CHML |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in purkinje cells. |
|
|
Western blot analysis using Anti-CHML antibody HPA029628 (A) shows similar pattern to independent antibody HPA029627 (B). |
|
|
HPA029628-100ul |
|
|
|
|
|
HPA029628-100ul |
|
|
HPA029628-100ul |
Product Guarantee and Expert Support
