Anti-CGA
Artikelnummer:
ATA-HPA029698
- Bilder (7)
| Artikelname: | Anti-CGA |
| Artikelnummer: | ATA-HPA029698 |
| Hersteller Artikelnummer: | HPA029698 |
| Alternativnummer: | ATA-HPA029698-100,ATA-HPA029698-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FSHA, GPHa, GPHA1, HCG, LHA, TSHA |
| glycoprotein hormones, alpha polypeptide |
| Anti-CGA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1081 |
| UniProt: | P01215 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CGA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemistry analysis in human placenta and prostate tissues using Anti-CGA antibody. Corresponding CGA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human pituitary gland shows strong positivity in anterior lobe. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA029698-100ul |
|
|
HPA029698-100ul |
|
|
HPA029698-100ul |
Produktgarantie und fachkundiger Support
