Anti-CGA
Catalog Number:
ATA-HPA029698
- Images (7)
| Article Name: | Anti-CGA |
| Biozol Catalog Number: | ATA-HPA029698 |
| Supplier Catalog Number: | HPA029698 |
| Alternative Catalog Number: | ATA-HPA029698-100,ATA-HPA029698-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FSHA, GPHa, GPHA1, HCG, LHA, TSHA |
| glycoprotein hormones, alpha polypeptide |
| Anti-CGA |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 1081 |
| UniProt: | P01215 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CGA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemistry analysis in human placenta and prostate tissues using Anti-CGA antibody. Corresponding CGA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human pituitary gland shows strong positivity in anterior lobe. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA029698-100ul |
|
|
HPA029698-100ul |
|
|
HPA029698-100ul |
Product Guarantee and Expert Support
