Anti-APEH
Artikelnummer:
ATA-HPA029703
- Bilder (9)
| Artikelname: | Anti-APEH |
| Artikelnummer: | ATA-HPA029703 |
| Hersteller Artikelnummer: | HPA029703 |
| Alternativnummer: | ATA-HPA029703-100,ATA-HPA029703-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | D3F15S2, D3S48E, DNF15S2 |
| acylaminoacyl-peptide hydrolase |
| Anti-APEH |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 327 |
| UniProt: | P13798 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | APEH |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm. |
|
|
Immunohistochemical staining of human colon using Anti-APEH antibody HPA029703. |
|
|
Immunohistochemical staining of human pancreas using Anti-APEH antibody HPA029703. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-APEH antibody HPA029703. |
|
|
Immunohistochemical staining of human kidney using Anti-APEH antibody HPA029703. |
|
|
HPA029703-100ul |
|
|
|
|
|
HPA029703-100ul |
|
|
HPA029703-100ul |
Produktgarantie und fachkundiger Support
