Anti-APEH
Catalog Number:
ATA-HPA029703
- Images (9)
| Article Name: | Anti-APEH |
| Biozol Catalog Number: | ATA-HPA029703 |
| Supplier Catalog Number: | HPA029703 |
| Alternative Catalog Number: | ATA-HPA029703-100,ATA-HPA029703-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | D3F15S2, D3S48E, DNF15S2 |
| acylaminoacyl-peptide hydrolase |
| Anti-APEH |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 327 |
| UniProt: | P13798 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | APEH |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm. |
|
|
Immunohistochemical staining of human colon using Anti-APEH antibody HPA029703. |
|
|
Immunohistochemical staining of human pancreas using Anti-APEH antibody HPA029703. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-APEH antibody HPA029703. |
|
|
Immunohistochemical staining of human kidney using Anti-APEH antibody HPA029703. |
|
|
HPA029703-100ul |
|
|
|
|
|
HPA029703-100ul |
|
|
HPA029703-100ul |
Product Guarantee and Expert Support
