Anti-PGM3
Artikelnummer:
ATA-HPA029759
- Bilder (8)
| Artikelname: | Anti-PGM3 |
| Artikelnummer: | ATA-HPA029759 |
| Hersteller Artikelnummer: | HPA029759 |
| Alternativnummer: | ATA-HPA029759-100,ATA-HPA029759-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AGM1, DKFZP434B187, PAGM |
| phosphoglucomutase 3 |
| Anti-PGM3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5238 |
| UniProt: | O95394 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KPPQGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PGM3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human prostate and skeletal muscle tissues using Anti-PGM3 antibody. Corresponding PGM3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis using Anti-PGM3 antibody HPA029759 (A) shows similar pattern to independent antibody HPA029760 (B). |
|
|
HPA029759-100ul |
|
|
|
|
|
HPA029759-100ul |
|
|
HPA029759-100ul |
Produktgarantie und fachkundiger Support
