Anti-PGM3
Catalog Number:
ATA-HPA029759
- Images (8)
| Article Name: | Anti-PGM3 |
| Biozol Catalog Number: | ATA-HPA029759 |
| Supplier Catalog Number: | HPA029759 |
| Alternative Catalog Number: | ATA-HPA029759-100,ATA-HPA029759-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AGM1, DKFZP434B187, PAGM |
| phosphoglucomutase 3 |
| Anti-PGM3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5238 |
| UniProt: | O95394 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KPPQGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PGM3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human prostate and skeletal muscle tissues using Anti-PGM3 antibody. Corresponding PGM3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis using Anti-PGM3 antibody HPA029759 (A) shows similar pattern to independent antibody HPA029760 (B). |
|
|
HPA029759-100ul |
|
|
|
|
|
HPA029759-100ul |
|
|
HPA029759-100ul |
Product Guarantee and Expert Support
