Anti-SLC25A20
Artikelnummer:
ATA-HPA029863
- Bilder (7)
| Artikelname: | Anti-SLC25A20 |
| Artikelnummer: | ATA-HPA029863 |
| Hersteller Artikelnummer: | HPA029863 |
| Alternativnummer: | ATA-HPA029863-100,ATA-HPA029863-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAC, CACT |
| solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 |
| Anti-SLC25A20 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 788 |
| UniProt: | O43772 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC25A20 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & mitochondria. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SLC25A20 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424755). |
|
|
HPA029863-100ul |
|
|
|
|
|
HPA029863-100ul |
|
|
HPA029863-100ul |
Produktgarantie und fachkundiger Support
