Anti-SLC25A20
Catalog Number:
ATA-HPA029863
- Images (7)
| Article Name: | Anti-SLC25A20 |
| Biozol Catalog Number: | ATA-HPA029863 |
| Supplier Catalog Number: | HPA029863 |
| Alternative Catalog Number: | ATA-HPA029863-100,ATA-HPA029863-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CAC, CACT |
| solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 |
| Anti-SLC25A20 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 788 |
| UniProt: | O43772 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC25A20 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & mitochondria. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SLC25A20 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424755). |
|
|
HPA029863-100ul |
|
|
|
|
|
HPA029863-100ul |
|
|
HPA029863-100ul |
Product Guarantee and Expert Support
