Anti-FOXM1
Artikelnummer:
ATA-HPA029974
- Bilder (7)
| Artikelname: | Anti-FOXM1 |
| Artikelnummer: | ATA-HPA029974 |
| Hersteller Artikelnummer: | HPA029974 |
| Alternativnummer: | ATA-HPA029974-100,ATA-HPA029974-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FKHL16, HFH-11, HNF-3, INS-1, MPHOSPH2, MPP2, TGT3, trident |
| forkhead box M1 |
| Anti-FOXM1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2305 |
| UniProt: | Q08050 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FOXM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human rectum shows moderate nuclear positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in few cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human uterine cervix shows moderate nuclear positivity in a subset of epidermal cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected. |
|
|
HPA029974-100ul |
|
|
HPA029974-100ul |
|
|
HPA029974-100ul |
Produktgarantie und fachkundiger Support
