Anti-FOXM1
Catalog Number:
ATA-HPA029974
- Images (7)
| Article Name: | Anti-FOXM1 |
| Biozol Catalog Number: | ATA-HPA029974 |
| Supplier Catalog Number: | HPA029974 |
| Alternative Catalog Number: | ATA-HPA029974-100,ATA-HPA029974-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FKHL16, HFH-11, HNF-3, INS-1, MPHOSPH2, MPP2, TGT3, trident |
| forkhead box M1 |
| Anti-FOXM1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 2305 |
| UniProt: | Q08050 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FOXM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human rectum shows moderate nuclear positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in few cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human uterine cervix shows moderate nuclear positivity in a subset of epidermal cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected. |
|
|
HPA029974-100ul |
|
|
HPA029974-100ul |
|
|
HPA029974-100ul |
Product Guarantee and Expert Support
