Anti-HOPX
Artikelnummer:
ATA-HPA030180
- Bilder (8)
| Artikelname: | Anti-HOPX |
| Artikelnummer: | ATA-HPA030180 |
| Hersteller Artikelnummer: | HPA030180 |
| Alternativnummer: | ATA-HPA030180-100,ATA-HPA030180-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HOP, LAGY, NECC1, OB1, SMAP31 |
| HOP homeobox |
| Anti-HOPX |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84525 |
| UniProt: | Q9BPY8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HOPX |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human skin and liver tissues using HPA030180 antibody. Corresponding HOPX RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows moderate positivity in stratum granulosum. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA030180 |
|
|
HPA030180 |
|
|
HPA030180 |
Produktgarantie und fachkundiger Support
