Anti-HOPX
Catalog Number:
ATA-HPA030180
- Images (8)
| Article Name: | Anti-HOPX |
| Biozol Catalog Number: | ATA-HPA030180 |
| Supplier Catalog Number: | HPA030180 |
| Alternative Catalog Number: | ATA-HPA030180-100,ATA-HPA030180-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HOP, LAGY, NECC1, OB1, SMAP31 |
| HOP homeobox |
| Anti-HOPX |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 84525 |
| UniProt: | Q9BPY8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HOPX |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human skin and liver tissues using HPA030180 antibody. Corresponding HOPX RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows moderate positivity in stratum granulosum. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA030180 |
|
|
HPA030180 |
|
|
HPA030180 |
Product Guarantee and Expert Support
