Anti-IMPG1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA030333
Artikelname: Anti-IMPG1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA030333
Hersteller Artikelnummer: HPA030333
Alternativnummer: ATA-HPA030333-100,ATA-HPA030333-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GP147, IPM150, SPACR
interphotoreceptor matrix proteoglycan 1
Anti-IMPG1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 3617
UniProt: Q17R60
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DTGEYQDWVSICQQETFCLFDIGKNFSNSQEHLDLLQQRIKQRSFPDRKDEISAEKTLGEPGETIVISTDVANVSLGPFPLTPD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IMPG1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human cerebral cortex, colon, eye, retina and kidney using Anti-IMPG1 antibody HPA030333 (A) shows similar protein distribution across tissues to independent antibody HPA027142 (B).
Immunohistochemical staining of human eye, retina using Anti-IMPG1 antibody HPA030333.
Immunohistochemical staining of human colon using Anti-IMPG1 antibody HPA030333.
Immunohistochemical staining of human kidney using Anti-IMPG1 antibody HPA030333.
Immunohistochemical staining of human cerebral cortex using Anti-IMPG1 antibody HPA030333.
HPA030333
HPA030333
HPA030333