Anti-IMPG1
Catalog Number:
ATA-HPA030333
- Images (8)
| Article Name: | Anti-IMPG1 |
| Biozol Catalog Number: | ATA-HPA030333 |
| Supplier Catalog Number: | HPA030333 |
| Alternative Catalog Number: | ATA-HPA030333-100,ATA-HPA030333-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GP147, IPM150, SPACR |
| interphotoreceptor matrix proteoglycan 1 |
| Anti-IMPG1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 3617 |
| UniProt: | Q17R60 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DTGEYQDWVSICQQETFCLFDIGKNFSNSQEHLDLLQQRIKQRSFPDRKDEISAEKTLGEPGETIVISTDVANVSLGPFPLTPD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IMPG1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, eye, retina and kidney using Anti-IMPG1 antibody HPA030333 (A) shows similar protein distribution across tissues to independent antibody HPA027142 (B). |
|
|
Immunohistochemical staining of human eye, retina using Anti-IMPG1 antibody HPA030333. |
|
|
Immunohistochemical staining of human colon using Anti-IMPG1 antibody HPA030333. |
|
|
Immunohistochemical staining of human kidney using Anti-IMPG1 antibody HPA030333. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-IMPG1 antibody HPA030333. |
|
|
HPA030333-100ul |
|
|
HPA030333-100ul |
|
|
HPA030333-100ul |
Product Guarantee and Expert Support
