Anti-SLC35D3
Artikelnummer:
ATA-HPA030431
- Bilder (8)
| Artikelname: | Anti-SLC35D3 |
| Artikelnummer: | ATA-HPA030431 |
| Hersteller Artikelnummer: | HPA030431 |
| Alternativnummer: | ATA-HPA030431-100,ATA-HPA030431-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FRCL1 |
| solute carrier family 35, member D3 |
| Anti-SLC35D3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 340146 |
| UniProt: | Q5M8T2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC35D3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human adrenal gland shows moderate to strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human upper gastrointestinal shows moderate to strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lung shows moderate to strong granular cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human salivary gland shows moderate to strong granular cytoplasmic positivity in ductal cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA030431 |
|
|
HPA030431 |
|
|
HPA030431 |
Produktgarantie und fachkundiger Support
