Anti-SLC35D3 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA030431
- Images (8)
| Article Name: | Anti-SLC35D3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA030431 |
| Supplier Catalog Number: | HPA030431 |
| Alternative Catalog Number: | ATA-HPA030431-100,ATA-HPA030431-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FRCL1 |
| solute carrier family 35, member D3 |
| Anti-SLC35D3 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 340146 |
| UniProt: | Q5M8T2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC35D3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human adrenal gland shows moderate to strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human upper gastrointestinal shows moderate to strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lung shows moderate to strong granular cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human salivary gland shows moderate to strong granular cytoplasmic positivity in ductal cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA030431 |
|
|
HPA030431 |
|
|
HPA030431 |
Product Guarantee and Expert Support
