Anti-BMI1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA030472
Artikelname: Anti-BMI1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA030472
Hersteller Artikelnummer: HPA030472
Alternativnummer: ATA-HPA030472-100,ATA-HPA030472-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PCGF4, RNF51
BMI1 proto-oncogene, polycomb ring finger
Anti-BMI1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 648
UniProt: P35226
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BMI1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1, using Anti-BMI1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in human cell line HDLM-2.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA030472
HPA030472
HPA030472