Anti-BMI1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA030472
- Images (8)
| Article Name: | Anti-BMI1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA030472 |
| Supplier Catalog Number: | HPA030472 |
| Alternative Catalog Number: | ATA-HPA030472-100,ATA-HPA030472-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PCGF4, RNF51 |
| BMI1 proto-oncogene, polycomb ring finger |
| Anti-BMI1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 648 |
| UniProt: | P35226 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BMI1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1, using Anti-BMI1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis in human cell line HDLM-2. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA030472 |
|
|
|
|
|
HPA030472 |
|
|
HPA030472 |
Product Guarantee and Expert Support
