Anti-MRPL28 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA030594
Artikelname: Anti-MRPL28 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA030594
Hersteller Artikelnummer: HPA030594
Alternativnummer: ATA-HPA030594-100,ATA-HPA030594-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MAAT1, p15
mitochondrial ribosomal protein L28
Anti-MRPL28
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 10573
UniProt: Q13084
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MRPL28
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western blot analysis using Anti-MRPL28 antibody HPA030594 (A) shows similar pattern to independent antibody HPA055589 (B).
HPA030594
HPA030594
HPA030594
HPA030594
HPA030594