Anti-MRPL28
Catalog Number:
ATA-HPA030594
- Images (8)
| Article Name: | Anti-MRPL28 |
| Biozol Catalog Number: | ATA-HPA030594 |
| Supplier Catalog Number: | HPA030594 |
| Alternative Catalog Number: | ATA-HPA030594-100,ATA-HPA030594-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MAAT1, p15 |
| mitochondrial ribosomal protein L28 |
| Anti-MRPL28 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10573 |
| UniProt: | Q13084 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MRPL28 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-MRPL28 antibody HPA030594 (A) shows similar pattern to independent antibody HPA055589 (B). |
|
|
HPA030594 |
|
|
HPA030594 |
|
|
HPA030594 |
|
|
HPA030594 |
|
|
HPA030594 |
Product Guarantee and Expert Support
