Anti-ZNF711
Artikelnummer:
ATA-HPA030654
- Bilder (9)
| Artikelname: | Anti-ZNF711 |
| Artikelnummer: | ATA-HPA030654 |
| Hersteller Artikelnummer: | HPA030654 |
| Alternativnummer: | ATA-HPA030654-100,ATA-HPA030654-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CMPX1, dJ75N13.1, MRX97, Zfp711, ZNF4, ZNF5, ZNF6 |
| zinc finger protein 711 |
| Anti-ZNF711 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7552 |
| UniProt: | Q9Y462 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DVVTDDGITLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEADVAIEEDLEEDDGDHILTSELITETVRVPEQVFVADLVTGPNGHLEHVVQDCVSGVDSPTMVSEEVLVTN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ZNF711 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA030654 antibody. Corresponding ZNF711 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong nuclear positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
|
|
|
HPA030654-100ul |
|
|
HPA030654-100ul |
|
|
HPA030654-100ul |
Produktgarantie und fachkundiger Support
