Anti-ZNF711
Catalog Number:
ATA-HPA030654
- Images (9)
| Article Name: | Anti-ZNF711 |
| Biozol Catalog Number: | ATA-HPA030654 |
| Supplier Catalog Number: | HPA030654 |
| Alternative Catalog Number: | ATA-HPA030654-100,ATA-HPA030654-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CMPX1, dJ75N13.1, MRX97, Zfp711, ZNF4, ZNF5, ZNF6 |
| zinc finger protein 711 |
| Anti-ZNF711 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 7552 |
| UniProt: | Q9Y462 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DVVTDDGITLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEADVAIEEDLEEDDGDHILTSELITETVRVPEQVFVADLVTGPNGHLEHVVQDCVSGVDSPTMVSEEVLVTN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZNF711 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA030654 antibody. Corresponding ZNF711 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong nuclear positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
|
|
|
HPA030654-100ul |
|
|
HPA030654-100ul |
|
|
HPA030654-100ul |
Product Guarantee and Expert Support
