Anti-ADAM12 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA030868
Artikelname: Anti-ADAM12 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA030868
Hersteller Artikelnummer: HPA030868
Alternativnummer: ATA-HPA030868-100,ATA-HPA030868-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MCMPMltna, MLTN
ADAM metallopeptidase domain 12
Anti-ADAM12
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 8038
UniProt: O43184
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VTLAHELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRESFGGQKCGNRFVEEG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ADAM12
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human placenta and liver tissues using HPA030868 antibody. Corresponding ADAM12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows moderate positivity in trophoblastic cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
HPA030868
HPA030868
HPA030868