Anti-ADAM12
Catalog Number:
ATA-HPA030868
- Images (8)
| Article Name: | Anti-ADAM12 |
| Biozol Catalog Number: | ATA-HPA030868 |
| Supplier Catalog Number: | HPA030868 |
| Alternative Catalog Number: | ATA-HPA030868-100,ATA-HPA030868-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MCMPMltna, MLTN |
| ADAM metallopeptidase domain 12 |
| Anti-ADAM12 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 8038 |
| UniProt: | O43184 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VTLAHELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRESFGGQKCGNRFVEEG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ADAM12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human placenta and liver tissues using HPA030868 antibody. Corresponding ADAM12 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Western blot analysis in human cell line RT-4 and human cell line U-251 MG. |
|
|
|
|
|
HPA030868 |
|
|
HPA030868 |
|
|
HPA030868 |
Product Guarantee and Expert Support
