Anti-LGSN

Artikelnummer: ATA-HPA030957
Artikelname: Anti-LGSN
Artikelnummer: ATA-HPA030957
Hersteller Artikelnummer: HPA030957
Alternativnummer: ATA-HPA030957-100,ATA-HPA030957-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GLULD1, LGS
lengsin, lens protein with glutamine synthetase domain
Anti-LGSN
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 51557
UniProt: Q5TDP6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LGSN
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemical staining of human eye, liver, lymph node and testis using Anti-LGSN antibody HPA030957 (A) shows similar protein distribution across tissues to independent antibody HPA039983 (B).
Immunohistochemical staining of human eye using Anti-LGSN antibody HPA030957.
Immunohistochemical staining of human testis using Anti-LGSN antibody HPA030957.
Immunohistochemical staining of human lymph node using Anti-LGSN antibody HPA030957.
Immunohistochemical staining of human liver using Anti-LGSN antibody HPA030957.
HPA030957-100ul
HPA030957-100ul
HPA030957-100ul