Anti-LGSN Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-LGSN Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA030957
• Supplier Catalog Number: HPA030957
• Alternative Catalog Number: ATA-HPA030957-100,ATA-HPA030957-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GLULD1, LGS

Product Description

lengsin, lens protein with glutamine synthetase domain

Additional Information

Anti-LGSN

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 51557
• UniProt: Q5TDP6
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: LGSN
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500

Images

Immunohistochemical staining of human eye, liver, lymph node and testis using Anti-LGSN antibody HPA030957 (A) shows similar protein distribution across tissues to independent antibody HPA039983 (B).

Immunohistochemical staining of human eye using Anti-LGSN antibody HPA030957.

Immunohistochemical staining of human testis using Anti-LGSN antibody HPA030957.

Immunohistochemical staining of human lymph node using Anti-LGSN antibody HPA030957.

Immunohistochemical staining of human liver using Anti-LGSN antibody HPA030957.

HPA030957

HPA030957

HPA030957