Anti-VTA1
Artikelnummer:
ATA-HPA030968
- Bilder (7)
| Artikelname: | Anti-VTA1 |
| Artikelnummer: | ATA-HPA030968 |
| Hersteller Artikelnummer: | HPA030968 |
| Alternativnummer: | ATA-HPA030968-100,ATA-HPA030968-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C6orf55, HSPC228, My012 |
| vesicle (multivesicular body) trafficking 1 |
| Anti-VTA1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51534 |
| UniProt: | Q9NP79 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | VTA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in parietal cells. |
|
|
Western blot analysis using Anti-VTA1 antibody HPA030968 (A) shows similar pattern to independent antibody HPA030969 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA030968-100ul |
|
|
|
|
|
HPA030968-100ul |
|
|
HPA030968-100ul |
Produktgarantie und fachkundiger Support
