Anti-VTA1

Catalog Number: ATA-HPA030968
Article Name: Anti-VTA1
Biozol Catalog Number: ATA-HPA030968
Supplier Catalog Number: HPA030968
Alternative Catalog Number: ATA-HPA030968-100,ATA-HPA030968-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C6orf55, HSPC228, My012
vesicle (multivesicular body) trafficking 1
Anti-VTA1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 51534
UniProt: Q9NP79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: VTA1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Western blot analysis using Anti-VTA1 antibody HPA030968 (A) shows similar pattern to independent antibody HPA030969 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA030968-100ul
HPA030968-100ul
HPA030968-100ul