Anti-HDAC5
Artikelnummer:
ATA-HPA030991
- Bilder (9)
| Artikelname: | Anti-HDAC5 |
| Artikelnummer: | ATA-HPA030991 |
| Hersteller Artikelnummer: | HPA030991 |
| Alternativnummer: | ATA-HPA030991-100,ATA-HPA030991-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ90614, KIAA0600, NY-CO-9 |
| histone deacetylase 5 |
| Anti-HDAC5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10014 |
| UniProt: | Q9UQL6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | THPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HDAC5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles, cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity and strong nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebellum shows weak cytoplasmic positivity and moderate nuclear positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic and nuclear positivity in myocytes. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity and strong nuclear positivity in trophoblastic cells. |
|
|
HPA030991-100ul |
|
|
|
|
|
HPA030991-100ul |
|
|
HPA030991-100ul |
Produktgarantie und fachkundiger Support
